DPCstruct | MC63580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 149 ± 31 aa |
| Standard deviation of domain lengths | 30.61 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I1A3Q6 | 13-154 | TLYELSAEVVDRLGFPPALDWSENEVADWLATEVGFPEYKDCILDNHINGRRLIMLEDSFALTEINVKNFDHIKVITSKVRELYKME… |
| A0A0L8GMD0 | 2-94 | GFPFYQDCFIQNYVDGKKLIMADASTLCKLGIRDFQDIKTIAYQIRMLISLEEPDWNRSISLPPRSDWGMFLEMKSKTGKKTEEMEF… |
| A0A834XS27 | 12-173 | None |
| A0A226EQH0 | 102-259 | None |
| A0A6A4JVD1 | 420-578 | None |
| A0A1I8FG85 | 29-187 | None |
| A0A6A4VBB9 | 212-417 | None |
| T2M423 | 14-130 | None |
| A0A670HVR9 | 3-135 | None |
| V4B4Y0 | 6-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.