DPCstruct | MC6358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2FUD5 | 17-89 | TGRLYGLLGGASGAALGFILANIPGALAGAVVGNRLGAIRDSHSKPVYQVFQEMPHSEKANLLSQLLTKVMSQ |
| A0A1Y2B3Z2 | 13-101 | MHLKNFFIQEVPQPHTFWKRLGGAAGIVLGFILMNVPGAVACGIAGTKLGEIRNNKGCSVYDAFKKLDRDKKAEILSQLTKEVVQHT… |
| A6R3D8 | 231-338 | None |
| A0A409XFH6 | 913-997 | None |
| A0A420HBF5 | 1-91 | None |
| A0A2T9ZAR8 | 103-188 | None |
| A0A1Q3EQD6 | 58-147 | None |
| A0A0K8LHP6 | 559-665 | None |
| A0A2W1HTR2 | 137-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.