DPCstruct | MC63578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 174 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0ZU92 | 2-180 | TSVARRREQDDSGEYSDASQDIEQNNSGIDGAQHDTDYDSQGSETEHSEGDPEKQETERRVDDDEDRSNPQYIPKRGTFYEHDDRTA… |
| G3PQE4 | 1-138 | DDDSKEERKAEDNENLAGERQSGDGQESTDDPETKAAGKPGQKLDDDEDRKNPAYIPRKGLFFEHDVRGHAQEEERPKGRNRKLWKD… |
| A0A0D8XLE1 | 1-180 | None |
| A0A7R9JE50 | 7-171 | None |
| A0A6A4VVP6 | 2-166 | None |
| A0A6P3Y789 | 2-185 | None |
| Q1ECZ4 | 100-299 | None |
| A0A1D2NIX3 | 3-171 | None |
| A0A4U5LTB7 | 28-191 | None |
| A0A0B1SGX8 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.