DPCstruct | MC63577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0ZRJ6 | 5-137 | LAYYADAVMLAARGTGCALGCSGRGDCMNGTCLCEIRYSGDECAGPNLPYHACIGGVFLMVAFVCAVQLTVCVVTEYKRLKAPTILR… |
| A0A1B0CSS5 | 25-135 | ACSGRGDCLNGTCLCEIRYSGDECSTFNLPYHAGVSSIFYFVALVSLIQLLICIVAEYQRLKQPSFLRACRLTTQKLLYFFVFVAAL… |
| A0A6G5AE63 | 16-167 | None |
| A0A7R9DIN5 | 30-167 | None |
| A0A182IQP9 | 18-128 | None |
| A0A7R9B1P2 | 51-218 | None |
| A0A7R9NWQ4 | 197-319 | None |
| A0A1D2NJ48 | 3-131 | None |
| A0A4C1XZN9 | 2-142 | None |
| A0A7R8WFD5 | 8-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.