DPCstruct | MC63570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8USY7 | 15-97 | ARFQNMKSELDEDLNPYEHITEYNNFYEFGAQKEDPARNAGDFRPRPWTVRIEGHVNKPGDYQLEDFIGPSNMEDRVYRMRCV |
| A0A3S4K628 | 4-84 | SQPAAWRSDLALTPEDKVTGYNNFYEFGLDKADPAANAGSLKTEPWTLKISGEVAKPFTLDYDDLTHRFPLEERIYRMRCV |
| A0A340XE47 | 346-424 | None |
| A0A376SAW0 | 3-87 | None |
| A0A3A1VSL1 | 66-152 | None |
| A0A378BLH5 | 1-75 | None |
| A0A0D2MTF3 | 520-616 | None |
| A0A7V8JR83 | 1-76 | None |
| A0A6N6X7D2 | 9-93 | None |
| A0A5C9BUT9 | 31-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.