DPCstruct | MC6357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 2 aa |
| Standard deviation of domain lengths | 1.59 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 95.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243R9G6 | 78-158 | HEIAHTIGVGTSSGWSRLGGSGTWTGGQATALVKQYDGSGAKISTGGGHFWPYGLNFENEMSSTAADRHVHLVAAMVRDGL |
| A0A257M2W1 | 93-171 | HEISHALGVGQVAAWNTNRSGNIWTGTFATNRVKLFDGPSATLSADSMHFWPYGLNFASEDSTTNRVRHVKMVSAMRRD |
| A0A2R7LVB8 | 199-279 | None |
| A0A4Q6DHM1 | 187-264 | None |
| A0A521ZLQ5 | 282-360 | None |
| A0A4V1SB10 | 110-188 | None |
| A0A2R7KMG6 | 139-221 | None |
| A0A3R8SHS4 | 103-184 | None |
| A0A7C2DD53 | 458-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.