DPCstruct | MC63561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A209B7M2 | 9-121 | FDPHAFPAGLLAAQRQAAELYAALRAHQATLPWSREPHDGWPEETERGRENSGRPASPGRTAAEANEFDRLLDELPTATAQVQCHPW… |
| A0A059W5D9 | 1-99 | MDFPADLVAAQRDLTQTRDQYVQLCAGLPWSAEPHPGWDDTATGGTRRDPSDGYTPEDAAELQRLHERLRELAAIVTTHAFWSTLDG… |
| A0A4Q8C907 | 2-92 | None |
| A0A4D4MF24 | 64-164 | None |
| A0A1H0BLU3 | 27-133 | None |
| A0A7H8T9Z8 | 26-137 | None |
| A0A2M9LZD5 | 20-126 | None |
| A0A101RK38 | 1-84 | None |
| A0A1C4I3R1 | 4-107 | None |
| A0A5R9E6J7 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.