DPCstruct | MC6356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 237 ± 36 aa |
| Standard deviation of domain lengths | 36.19 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0UCH5 | 6-234 | LTQQSRPDTFQPKIVKLYETLFLNAEDAEPSEGFWREFFLLPPQRVRLSQILDVISPDDILQIHFHTQQLFSKAIKEAAAGESPSNI… |
| A0A1Y2AZS8 | 16-231 | KFIYYIDEFFQGNNPSNGIENFWDEFFLYNVNIRYIANKFDTLSDESIIQLKEIFLLLIENSIIILKNSVKNKKKQEENDIHDSQTN… |
| A0A135RW00 | 334-613 | None |
| A0A444T568 | 2-195 | None |
| A0A132A271 | 1-212 | None |
| A0A4V1XU28 | 1-212 | None |
| A0A5N5QTU8 | 2-261 | None |
| A0A1X7TJ70 | 2-208 | None |
| A0A2S5BBI2 | 3-351 | None |
| A0A094ZR46 | 2-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.