DPCstruct | MC63555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239LND8 | 1-116 | MFLDIPKLQVDKIEIDVANLRAQVSLNAEVLSLLRLNVGVDAAIDQVHLTIEGVDAQAQLKVRLENVAHIIDRVLGTIDDHPEIITP… |
| A0A4R4ETD8 | 1-110 | MPGDQPDVFLDVPNLSVDEIKLDVQNLEAHIALNARLANLLSLNAGADVGIERVNIQIKGVKAQAQLIVRLDNVAAIIDRTLTTIDR… |
| A0A1W1ULJ4 | 71-209 | None |
| A0A6I4MDK6 | 2-114 | None |
| A0A223QKS4 | 1-124 | None |
| A0A023X656 | 16-156 | None |
| A0A1C4V3V2 | 1-141 | None |
| A0A1V5HDN1 | 105-221 | None |
| A0A2A2SDT8 | 1-117 | None |
| A0A820JMT2 | 3-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.