DPCstruct | MC63551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 2.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 57.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8AGP9 | 14-61 | NDLPGVTTSDCDYKGGLPGVDNGRIVFDQVRIPRENLLNRYGDVAPDG |
| H2ZII2 | 1-48 | MQIMPGVRVEDMGHKMGLNGVDNAKLFFDNVRVPRENLLNRYSEVEAD |
| A0A7J8E5A4 | 1-46 | None |
| A0A150G971 | 113-160 | None |
| W9RYD3 | 17-64 | None |
| A0A1S8WMK7 | 5-52 | None |
| A0A392NCT7 | 17-64 | None |
| A0A444CQQ4 | 227-274 | None |
| A0A6S7KT76 | 120-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.