DPCstruct | MC63550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3EEJ8 | 1-107 | MNNKCLVCLQNPKRDNYQFCSKFCTDRVARTAPQLLPVPDDHVMYRDVKTLFVNNWNWSTGYLPQIKRIYLITWSPSLRESFDSYRE… |
| A0A015LIH6 | 1-145 | MLNSLWCSKQCRDITQNWKSMVKTNELCLKCTQETTYFGKYFCGEDCEEWVNENGPCIFKLSKQGNKFKDISNQFMSSWKHENKVMP… |
| A0A5M3N0G0 | 68-195 | None |
| G4TS10 | 64-193 | None |
| A0A4Q2D2Z4 | 93-219 | None |
| A0A433PII2 | 2-149 | None |
| A0A165N6W2 | 78-208 | None |
| A0A2H3E7D6 | 86-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.