DPCstruct | MC6355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 305 ± 29 aa |
| Standard deviation of domain lengths | 29.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397S0S0 | 7-284 | GKFIFPKQKSILERVSACGDGVQVLGEKELEGYQLYIVEQWACDVIRRPYNTVIVFTGDPAHKVKACVVNIERGKIEHYPEKLKDLF… |
| A0A1Y2AVB2 | 3-281 | MKLCVLEINSMYALANENSSITVKENSLYLEGFQAYIVLDWVTDRSRLCKTIIVYTGNPNDRIHVCSINFLSPKREDYGQTIENLFK… |
| A0A3N4LP51 | 50-359 | None |
| A0A4U0WKF2 | 305-619 | None |
| A0A2V1AZ67 | 276-589 | None |
| A0A1V8UX25 | 25-379 | None |
| A0A1Y2F055 | 1-311 | None |
| A2FEB5 | 21-306 | None |
| A0A395IKX2 | 1-345 | None |
| A0A0L0S659 | 8-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.