DPCstruct | MC63546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5UCE4 | 1-108 | MLKWPVFLKDTDGYVYMYESEKELKYSVEYSDIVNKEYTGWDVNGREVSLEWVDSEPDIGEVVIKETGIVRYNHLKIAITEFAAKHG… |
| A0A844ZH98 | 8-126 | RDIIVINDSRGIANAGDVTLFRSAGEACRYVEPWWVKEDQGFVLTADGQKVTLGIDGRDVIVRRYEDFPDGRAIVLRWLQYSAQAIL… |
| A0A1S1Y9F3 | 45-170 | None |
| A0A7U0G1M0 | 1-140 | None |
| A0A1H1MTN9 | 33-147 | None |
| A0A7K2FLS9 | 2-120 | None |
| A0A845ZIT0 | 121-256 | None |
| A0A7W9VDK1 | 16-136 | None |
| A0A5C4RW87 | 68-187 | None |
| A0A6L5FXV1 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.