DPCstruct | MC63541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0511- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835LJU0 | 280-351 | HKCGDTSHWKIQCPWNNCVCNNKMCGGERSLKTTQNGLNTRRKYLKCSLCLSFEWLSNAMREARQKTEKFDP |
| A0A200QRQ3 | 1-91 | MGGGEGSSSHSQDSCQMCEQKGHTGIECSWAYSRCKLTPCNGVRKIVIAKTEANYGRRFLRCQQPDCSGFQCLDDALGSVGSQSTQL… |
| A0A7J7L0D3 | 1-70 | None |
| A0A835J1Q2 | 10-107 | None |
| A0A835IWK8 | 1-89 | None |
| A0A7J7P7D3 | 242-320 | None |
| A0A6P4C0J1 | 49-161 | None |
| A0A7J7L0B9 | 2-85 | None |
| A0A7J7L1Y3 | 18-99 | None |
| A0A835IMA8 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.