DPCstruct | MC63536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 135 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 66.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04844 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4CZ06 | 1-143 | MEEDDNLLYSSSADSDTCDDELPPHLPSVISSKRFFFSSPSQSNSIIDQHVIEGGVGVTKHSLDPYMDFRRSMQEMVHSRDTQDCEY… |
| A0A7J6UXQ5 | 25-101 | SFSASLPNDVQGIYADSLCAVKYSMDPLVDLKESIIEMVKNVGVRNWEDMEELIYCYVVLNSTEIHGFIVEAFLSLC |
| A0A6J5WQ20 | 38-148 | None |
| A0A7N0VBB4 | 9-132 | None |
| A0A6V7NZY2 | 199-319 | None |
| A0A843US19 | 181-286 | None |
| A0A5A7R6D7 | 15-180 | None |
| A0A835RZA8 | 113-274 | None |
| B9R7S2 | 217-322 | None |
| A0A6A2YUZ1 | 5-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.