DPCstruct | MC6353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LRA6 | 1-65 | MAHTVLLVQASELETRQYSDYDNLPDALQGVCHMFEQHLKKSFPKNTEIQYDLSQLFAYIDELTD |
| A0A1Y2ANG8 | 1-95 | MTQHTIILIQRKKGRNSRTYMDFNTVALAVEEIIRLYEQFLQEQNPNARNINYDISDLNGYIDRFEDIGCLVYEPSIQAYIPHDRDW… |
| A0A5A9NJV7 | 464-568 | None |
| A0A1Y2H584 | 8-118 | None |
| A0A7M3RFC7 | 207-310 | None |
| D3B2W1 | 500-595 | None |
| A0A1B0A8C4 | 2-98 | None |
| A0A7J7F4C8 | 151-246 | None |
| A0A540KNG4 | 163-253 | None |
| A0A2K5Q640 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.