DPCstruct | MC63528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 396 ± 70 aa |
| Standard deviation of domain lengths | 70.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418V607 | 269-631 | WTQAYDVTNSDVTGDKKADYRMPPIWEYGTRKASLGYSRKVSPDLALVTRYVALNLLFTPSPIYRVALTPPELPNDIVLDYHVEQGA… |
| A0A6I9WB40 | 66-441 | KITVAALSVNRAELLAREIKQTFANADIAKLMQVLSEWILHDKSLALTKNTLAEPTLYNLDEENRRRFPASLTYDVLITLVNPDPEK… |
| A0A654HUP1 | 600-955 | None |
| A0A2R7Y1U6 | 243-661 | None |
| A0A4Y7LEA2 | 36-294 | None |
| A0A4Y7L2W9 | 245-628 | None |
| A0A1V8S7X7 | 19-346 | None |
| A0A843CLV8 | 66-447 | None |
| A0A4Q2DD96 | 37-283 | None |
| A0A507DPZ6 | 329-872 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.