DPCstruct | MC63512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0733- PF08883- PF11807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0X7P6 | 3-95 | DIHGYHAHIYFNAQTLDQARALCEAATEKFAVQMGRVHQKRVGPHPDWSCQLAFGHEQLADVTLWLALNRDGLVVFLHPLTGDELRD… |
| A0A197JBD1 | 18-153 | PYTNTSTSTNADLQSDYDNEIKEFHFHLYWFQNNKASHESAVKLRDRILELVRQGFFQVVPLKNGINTSPRGPHPIGSYEVWCARED… |
| A0A7S4MHL9 | 71-212 | None |
| A0A7S4HZH0 | 9-149 | None |
| A0A0H2RMR2 | 72-197 | None |
| A0A6A5S8K3 | 49-159 | None |
| A0A1B7MKH3 | 20-131 | None |
| A0A537M5V4 | 2-102 | None |
| A0A6G0XTF8 | 11-117 | None |
| A0A7S2V081 | 284-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.