DPCstruct | MC6351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 107 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1X006 | 86-205 | ALVCRHCLAYATGTDGNYWGFEYDNVCILSEECKEEIHNKHSVLRSAHDNIRICRRCHYTKKDNITRTMWNIEDNEECRVVHSRCPN… |
| A0A1Y2AFG5 | 41-140 | GIENEDWCILPDSCFDSCWASSLGYSCCKGCDIIITDSNGDWGVEDNEWCGILSTCKESKASCWSLANGYDCCEGCEVAYTDADGKW… |
| A0A1Y1X6M7 | 14-114 | None |
| A0A1Y1X6K8 | 584-693 | None |
| A0A1Y1X422 | 3-106 | None |
| A0A1Y1X089 | 569-678 | None |
| A0A1Y1X015 | 139-248 | None |
| A0A1Y1WTD7 | 318-424 | None |
| A0A1Y1WGC9 | 434-540 | None |
| A0A1Y1VZW4 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.