DPCstruct | MC63506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 3 aa |
| Standard deviation of domain lengths | 3.43 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1NIB9 | 3-89 | CKLVLPVEDCECKISSTMKGFCSKCMCPVCLNFDCANNTRSWVRCDVCSHCCHTACGLELIFIKSGPSLKGAAGTTEVQFHCMGCGH |
| A0A199VR63 | 175-268 | LYKRCRNIACQSALPADECRCDICSSRSGFCNLCMCVICSKFDFEVNTCRWIGCDQCSHWTHTDCAIRVGQIGTGLSVKNGVSHPEM… |
| A0A1D6EKV3 | 374-469 | None |
| A0A6A1VCQ1 | 82-177 | None |
| A0A251S753 | 365-460 | None |
| A0A7I8IMH1 | 189-284 | None |
| A0A0V0IQ77 | 89-184 | None |
| A0A6I9QIT3 | 829-931 | None |
| A0A835D6C3 | 85-177 | None |
| W1PLU8 | 592-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.