DPCstruct | MC63492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 291 ± 31 aa |
| Standard deviation of domain lengths | 30.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 13.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5SIQ5 | 6-294 | VGLSVIAAFVLMAVSAHLNYGFMAGFAHTSEAAMALGAAAVAGDILKACLPFFLVLAWRSRRWLFLVLGAPAWGLLSAVSLLAALGY… |
| A0A1J5S3M0 | 3-249 | TATARVMAIIITAIALVMSGMAGWYRGSSLLDRMLLISISVAISACSHLIPSISKSRVAWALWSCCFIGALYSHLTFFSYTSLHAGD… |
| A1ZEI9 | 58-381 | None |
| A0A5C7PG80 | 2-285 | None |
| A0A2A4NS78 | 112-337 | None |
| A0A158DQH1 | 154-457 | None |
| A0A4Y9LSM9 | 152-406 | None |
| A0A1W9WBS0 | 1-327 | None |
| A1ZME6 | 47-379 | None |
| A0A4Q0Q8R3 | 76-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.