DPCstruct | MC63491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 286 ± 38 aa |
| Standard deviation of domain lengths | 38.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5RQW4 | 129-414 | KSQIDVSAAVKEVNTGLAAVALAKTNAEAAVTSMQIMQAQLAELSPKAVNDGASISKIESESRAILSTLNKVVTSANEAQANVAEYE… |
| A0A4Y6J3J6 | 1-259 | MQDSDLTKRRNSEKASFSQLRNQLDETTHKLIGEADYLKDSFSSWDEKTRAGWRSWLEDVSSEHTRQKETQKSEHENQQASQKEEFI… |
| A0A5A7NMI7 | 197-489 | None |
| A0A162Z228 | 114-418 | None |
| A0A6M5F9T4 | 43-361 | None |
| A0A7Y4SRB8 | 196-571 | None |
| A0A4R1KRL8 | 10-289 | None |
| A0A0G1JSK9 | 3-216 | None |
| A0A1M3HHT5 | 146-407 | None |
| A0A661IVT4 | 365-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.