DPCstruct | MC6349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 217 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2E2J0 | 451-642 | YEKECDVVSGVSCTDGSYHLKNTELFYCEKQGDPCQSVSDVGYFIVDETTIFFCKKNGITLECGSLANVANEENCSNALVGEVAMIN… |
| A0A1Y2ABG5 | 1-208 | MYIYYVHLLRICEKTYYLVNKAENYALSEEEGALFYCDPENAKEVCSEIFDVGYYIVDKETIYSCKAGSNGLDCSRGELTDQDNTCA… |
| A0A1Y2B4J8 | 608-824 | None |
| A0A1Y3NPW0 | 288-488 | None |
| A0A1Y2BI18 | 2-222 | None |
| A0A1Y2BC21 | 243-450 | None |
| A0A1Y2B4G9 | 4-230 | None |
| A0A1Y2B3U1 | 302-548 | None |
| A0A1Y2B3I2 | 52-256 | None |
| A0A1Y2D497 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.