DPCstruct | MC63485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 226 ± 47 aa |
| Standard deviation of domain lengths | 46.57 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 98.18 |
| Assigned Pfam label(s) | PF11669- PF10417- PF03820 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5G2S1 | 7-246 | VNLDRPRWDQSTYFGRARHFFTVANPLNLRYTSRDLDKAKAIVENHRKGLPQQNALTLDELWKAKHIYDSAFHPVTGEKIFILGRMS… |
| J9IWD5 | 78-369 | LETYWGRFQHQFTRINPSLFFVSKKTIKECQEKIEKFKIREEAADNIGAKVYLKPDEIKEHIYANRVVGSAVHPDTKQIQDPYLRLS… |
| A0A2R9B890 | 38-278 | None |
| A0A158R353 | 26-242 | None |
| A0A0N4VXB2 | 2-142 | None |
| A0A1S3FNB4 | 12-185 | None |
| A0A670IWB2 | 161-431 | None |
| A0A0D8XPI2 | 1-147 | None |
| A0A6B0RUW9 | 84-372 | None |
| L8Y997 | 14-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.