DPCstruct | MC63484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 13.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1WZR2 | 13-119 | ANESVLTYLNTCRVPQFATRATILFCELFVSREMYGEAAKMFIQMTNEDSDLRSALLLEQAAYAFLKSQKPPMLRKYAFHMVLAGHR… |
| A0A446THW7 | 246-360 | SRKDAEYCMENAFTTYLRIGSSGQRNATRCGLWWAEMLKTRGQHREASTVYFRISNEEPSLHSAVLLEQAACCYLLSSPHMLRKYGF… |
| A0A287SJF3 | 117-231 | None |
| A0A820PBJ9 | 1-113 | None |
| A0A438GKC5 | 6-104 | None |
| A0A3Q0J7Q8 | 67-167 | None |
| A0A0M3J177 | 206-299 | None |
| A0A819JXK0 | 161-296 | None |
| A0A0L0FRN4 | 4-118 | None |
| A0A6I9P1S3 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.