DPCstruct | MC63477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 72 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 94.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.55 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0277- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1AU44 | 65-127 | CADICQQIRAGSTSIAGIMAESFLQEGTQKVVAGQPLTRGQSITDPCLSWEDSERLLAELAAA |
| A0A4U9UPQ5 | 1-49 | MIESHLVEGNQNLESGEPLVYGKSVTDACIGWEDTETVLRDLAAAVKAR |
| A0A0C9UD02 | 1-55 | None |
| A0A421JUL4 | 995-1073 | None |
| J6ER95 | 512-605 | None |
| A0A378A563 | 1-51 | None |
| A0A655SU99 | 6-66 | None |
| A0A7S0DIT9 | 330-428 | None |
| F0WTK3 | 257-330 | None |
| A0A2S7YLP0 | 479-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.