DPCstruct | MC6347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2C0C4 | 32-99 | AIESNNIKLVELILNYAIDNNIILKVNENDINNISEINTDIIMLLNKNKNKNKIDITYSDNSKFLERI |
| A0A1Y1ZTG7 | 7-88 | YNNYEMVKLLIDYGYENDIILAVNEDQICLISELDTEIIELLYKCYDAFEMTITFSEDSILLKKMKEIKNNLDGVNISNRTI |
| A0A1Y3NM72 | 610-689 | None |
| A0A1Y3NBE9 | 224-316 | None |
| A0A1Y3N994 | 283-368 | None |
| A0A1Y3MST1 | 135-217 | None |
| A0A1Y2AMR6 | 1-88 | None |
| A0A1Y2BNT3 | 1-101 | None |
| A0A1Y2ALR2 | 71-163 | None |
| A0A1Y2AKZ7 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.