DPCstruct | MC63469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 173 ± 28 aa |
| Standard deviation of domain lengths | 27.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0020- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2MLC9 | 520-700 | MKQHEMLLSDMRQVVQEEVKKALREQTTAVLNSRSTTPVPHADPQFQKQQLMQLVKQGNINEAFQQALSAMDVQLVLFLCESVNVDL… |
| A0A2R7WKM7 | 5-127 | GQYNTAFQQALSASDLSLVTYTCERVDVSKVFTRNGCVLQQHVLLSLIQQLSADMSAHVEIKLRYLEAAVMSLMPNNENTRDHMPQV… |
| A0A0A9LI19 | 39-220 | None |
| A0A6A1UUK8 | 40-206 | None |
| A0A1N6LX93 | 542-748 | None |
| A0A7S1SIN9 | 71-269 | None |
| A0A3Q0KLN6 | 1362-1536 | None |
| A0A0P0VNW0 | 169-350 | None |
| A0A7C9DH35 | 147-311 | None |
| A0A0A9D7F3 | 721-901 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.