DPCstruct | MC63467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 37.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376HDB2 | 1-92 | MLYRLRLAQARLKGVQARSAKAAIKKELLPDFSGWIEGTLEADGGQQDEVIATLMVWAIDCGDLPLALRIGAYVVRHNLIMPDNFGR… |
| A0A7M1L6U5 | 4-81 | LYEFKKRLKDVQSMAGKAQLKAKLLPDMDDYLNGVMASDAGTQDEVLMTALIWNIDAGLYRRALELAKYAVRHELKMP |
| A0A5T7ZCQ5 | 1-87 | None |
| A0A5E7HPM6 | 37-123 | None |
| A0A0J7Y416 | 24-114 | None |
| A0A8A9EGI2 | 33-119 | None |
| A0A5M6I6Q5 | 34-119 | None |
| A0A1M2PG27 | 1-86 | None |
| A0A418WP22 | 31-127 | None |
| C0B389 | 393-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.