DPCstruct | MC63466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376DF91 | 21-128 | GWRYTNIGVIRSENTESEFRNLYMCEFVRDGEAAFSLSALTGCGVDGYDEWPDWKPFAARPMGVREVWLGYDANGSSGKGDCGALSV… |
| Q8XY24 | 351-471 | NLFDLDQLRLEYSEPEFANLLMCAFIDDNASVFPLSMLMRGMVDSWEAWEDFRPFAPRPFGNRPVWVGYDPNGGGGDSAALVVVAPP… |
| A0A4D0PW75 | 34-157 | None |
| A0A376YLL5 | 146-265 | None |
| A0A2X4DAR8 | 127-250 | None |
| A0A485B863 | 5-135 | None |
| A0A0N1JQ37 | 176-299 | None |
| A0A2X2S3X1 | 1-118 | None |
| A0A377CZB1 | 333-455 | None |
| A0A3M5W0E3 | 94-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.