DPCstruct | MC63460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Standard deviation of domain lengths | 16.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.35 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0039- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5SS47 | 1-168 | MAHIWRVKNFLTCMCYSHSGGVYMYSNHQGCDGGRLYYDGCASVVVNGDLVAQGSQFSLKDVEVVIAQIDLEAVASLRGSISSFQEQ… |
| A0A3F2S540 | 412-580 | QLRKLDQRMDLIRGATTKSGGVYLYSNQQGCDGGRMYYDGCAVIVVNGQVVAQGSQFSVKDVEVVTATVDLDDVRSYRGSVSSRCEQ… |
| A0A822HW39 | 21-195 | None |
| E3MM52 | 182-397 | None |
| A0A1R1XFV3 | 89-254 | None |
| A6R5W3 | 117-301 | None |
| M5E736 | 567-749 | None |
| A0A7C2DWR9 | 2-154 | None |
| A0A1I7WZV2 | 84-234 | None |
| A0A1S3DQT8 | 65-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.