DPCstruct | MC63455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226DH09 | 43-192 | GRDEISKLQQRAMLPRGTCWKSALEDLSVSCKGMIPEHQSRLAFKFTTCYNEMVGFPSVICERNMAIPDCMKSLDVSSQGTFREFFL… |
| A0A2P6VHM4 | 49-204 | EGQVQLESLSERAAAEGFLDRLLGTNCFSTAVQELNADCRRMDQEAKTRLALRLANCQMATQGGPTHHCAPRQPLKECIEALPERVY… |
| A0A834LDR4 | 48-223 | None |
| A0A5J4Z046 | 27-184 | None |
| H3AND1 | 8-160 | None |
| M0ZKA9 | 6-145 | None |
| A0A4U5QLZ6 | 60-210 | None |
| A0A7J7HIH0 | 5-121 | None |
| A0A812I917 | 784-931 | None |
| W5NBV2 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.