DPCstruct | MC63452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 181 ± 33 aa |
| Standard deviation of domain lengths | 33.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4QSZ2 | 14-221 | KKIITLFTAAMLLTAIVFLFIGKNPDRKGRLIFTIGQLLLMMVIIILPEQLKERIGLKIPLLLETTLTVFAFCGFVLGDVFDFYGKI… |
| A0A1C6DRI4 | 39-232 | EAVFKKINWALMALIAIGHLAAGIYYLASGARVYYYALAFCGLLFLPLPYGLYKALRVKTCYSLNCVIYAFFILAYTIGLVYQGYAR… |
| A0A7D5GNP6 | 227-420 | None |
| A0A357YA16 | 5-126 | None |
| A0A1Q7WGI2 | 29-216 | None |
| A0A449BKV0 | 4-212 | None |
| A0A1V4MBL4 | 3-171 | None |
| A0A355FZY9 | 4-257 | None |
| A0A6G8TBS3 | 1-207 | None |
| A0A0S9D8I6 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.