DPCstruct | MC63446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5L6F7 | 168-285 | VTGSIGEAMELANLSAPEHLEILTAEPFGLLPYVKHAGAVFLGPWSPEPLGDYLAGPNHVLPTGGTARFYSVLNVETFMKKTSIIAY… |
| A0A377K468 | 4-120 | DLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGDYASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKE… |
| A0A520N1S0 | 283-417 | None |
| A0A7V3AFT1 | 191-309 | None |
| A0A418WGJ6 | 517-650 | None |
| A0A2D6PU53 | 7-119 | None |
| A0A0F9P0S0 | 2-96 | None |
| A0A022QK52 | 350-466 | None |
| R7CGW4 | 11-141 | None |
| A0A4V3WQZ9 | 59-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.