DPCstruct | MC63445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 139 ± 22 aa |
| Standard deviation of domain lengths | 22.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6DYD3 | 4-130 | QRTIKKIIKASGTGLHSGKNVLINFLPHHIDGGIVFRRIDLDPPVDIPASALLVQETVMSSNLVVGEVRIGTVEHLMSALAGMGIDN… |
| A0A6A5L0P2 | 4-141 | MQKTLQQEVTLSGIGLHTGKEVKLTMKPAKENTGFVFVRTDLEGHPQVEADVNYVVATERGTTLEKLGVKITTCEHLLAALVGCDID… |
| A0A4S8ILX8 | 115-238 | None |
| A0A7V0YUW7 | 1-150 | None |
| A0A7X6ZI01 | 40-138 | None |
| A0A5J4YHS9 | 3-152 | None |
| A0A2E9M8Y6 | 2-117 | None |
| A0A199VX95 | 5-150 | None |
| A0A0L9UTT4 | 53-154 | None |
| A0A7J7M7F2 | 146-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.