DPCstruct | MC63442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 604 ± 99 aa |
| Standard deviation of domain lengths | 98.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 73.32 |
| Assigned Pfam label(s) | PF03726- CL0329- CL0007- CL0021- PF03725 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5KTN3 | 264-916 | GDTTVLCTAVAAKAPKPGVDFFPLTVNYQEKAFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFADGFRNETQVVCTVLSHDL… |
| A0A2G9YCS3 | 22-553 | FAGRANGAVTVQYGDTLILATAVMAKKPREEVDYMPLMVDYEEKLYAAGKIKGSRWVKREGRPSDEAILTGRLIDRCLRPLFDERIR… |
| A0A7E4SGL6 | 336-1007 | None |
| A0A843U7B0 | 27-716 | None |
| A0A6F9C5Z8 | 5-486 | None |
| I0YP49 | 30-694 | None |
| A0A1Q7C8B0 | 8-669 | None |
| A0A4Y7L9F5 | 73-547 | None |
| A0A4Y7IJ97 | 46-728 | None |
| A0A2R2MQD2 | 16-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.