DPCstruct | MC6344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1YNW9 | 1-128 | MLLRSDGVYPYYYINKNNITNIIYLNHLLVESDRGISLANIEGLNSNNELTLKNKLQNKKFRCDNEANYIKNTLTFYDEFEIEIPIS… |
| A0A1Y2E222 | 465-586 | KKTHCSSLIQSDGEYPYYYIRNNITTFIYLTHKNIGEERGISINVDTLTSSSIFDKETFRNKEFICDQQANFEESTITYQDDYKLVI… |
| A0A1Y1XGZ6 | 250-389 | None |
| A0A1Y3NRA0 | 3-95 | None |
| A0A1Y3NQI4 | 1-142 | None |
| A0A1Y3NQH9 | 2-126 | None |
| A0A1Y3NL81 | 1-156 | None |
| A0A1Y1UV68 | 374-494 | None |
| A0A1Y1W974 | 45-176 | None |
| A0A1Y3NQN6 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.