DPCstruct | MC63430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 185 ± 28 aa |
| Standard deviation of domain lengths | 27.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814DM96 | 1-183 | MNELEIVLPCGFTTKYSNLPEKDAKFRCIECKSHLVDLNECLNMPRNWTTLKNMELDHQADLFKNFKQDLDIHKKDPDMYIKETLMQ… |
| A0A814GSQ9 | 1-129 | MDDIKIMLPCGFSTLYKNLKDKPDEIECFVCENHKIKIDECLKMSLNQLNLTLKKIELENDKYKSMKQNYESIIRNREFCESQNIEK… |
| A0A814D0N4 | 1-217 | None |
| A0A3M7RDC3 | 1-170 | None |
| A0A3M7RFN6 | 1-195 | None |
| A0A3M7QE57 | 12-166 | None |
| A0A3M7STW9 | 1-220 | None |
| A0A3M7PMV3 | 1-222 | None |
| A0A813MD71 | 1-212 | None |
| A0A813PNC5 | 18-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.