DPCstruct | MC6343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 232 ± 48 aa |
| Standard deviation of domain lengths | 48.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 65.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2AKR0 | 1-216 | MEYFKVQAYRYLISAKVLDQLEGFEILPNYERLCRILHKYAKTTQQMKLLWKAILNITGNSPDCINSSYVVDVWKELCMNDEYSHIC… |
| A0A1Y1YDV2 | 1-192 | MEYIKVSYRYLISAKVLDQLEEFEIQPSYERLCRSLHSCAKTTQQMKLLWRTILNIVGTSPDNISTLFVSKVWKDLCNDKKYSHICH… |
| A0A1Y3NK19 | 1-150 | None |
| A0A1Y1VXS2 | 39-299 | None |
| A0A4R4LVA1 | 16-280 | None |
| A0A1Y1VCT3 | 73-235 | None |
| A0A1Y1VC93 | 22-385 | None |
| A0A1Y1UZF7 | 27-265 | None |
| A0A1Y1UWC1 | 27-311 | None |
| A0A1Y3N9E6 | 21-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.