DPCstruct | MC6342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 163 ± 23 aa |
| Standard deviation of domain lengths | 22.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821R9A6 | 1-157 | MAKVKNKRNAGLADKVHRKKSEGVKKKLNPFEVHINKEKLKVLGKKSKHDRGLPGVSRAKAIQKRKETIGTEMKLLNKTNTFIDRRI… |
| A0A1Y1XSA0 | 2-194 | VNQKNSNVSALKRLKARLKNSGIIGENVSSKKKGFDKKELRKKTKEKLANLKKEANPFEIKFTKQKHDIMGRKIKGIQGKPGQARSK… |
| A0A540LGK0 | 1-132 | None |
| A0A814DMS3 | 2-151 | None |
| A0A6A4WDX2 | 1-162 | None |
| A0A6J8EK04 | 9-181 | None |
| A0A4W6CDB1 | 1-130 | None |
| A0A4Z2BJ15 | 1-154 | None |
| A0A6I8SWJ8 | 1-131 | None |
| A0A2U1JFQ3 | 373-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.