DPCstruct | MC63419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 91 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 93.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0WBA3 | 114-190 | EKILDNYRHTESIYADYSLVKAAKADIYGNLFYDGTDKNFNPIMLMAGKETLVEVDKYPVKLKLHERMMPGIYVDYI |
| A0A060Y6K6 | 90-161 | EKAITGDFALVKAWKADKAGNIVFRKTARNFNQPMCKAAKVTIVEVEEVVDVGTFSEEDIHIPSIYIHRIIK |
| A0A6G3VAQ0 | 31-129 | None |
| A0A6G3VNB6 | 1-61 | None |
| D9UQS8 | 94-188 | None |
| A0A2H5F3E5 | 236-321 | None |
| A0A7G2LX73 | 4-100 | None |
| A3V8P5 | 1-67 | None |
| A0A5N4DAS8 | 387-479 | None |
| A0A5N4DC68 | 234-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.