DPCstruct | MC63408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 248 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811NTS0 | 1-247 | MAGPTPTYSAIVSHTAAFLAELIAYPLLRRHLLSMAAAAAADGGGGQQHPAATLQALSLVSDALDTAASGSASPSSLRAPERLLRSL… |
| A0A453CXW8 | 111-336 | ALSALISLAAGTVKQFAKDEAFRAFLRSGCTSCVGESDHRAVLDLRVTVQTVERAAAVGEALLDPRELKRASLRLHSLASLDADEAL… |
| A0A444CDW2 | 66-332 | None |
| A0A2I0XCE5 | 187-443 | None |
| A0A835PKW3 | 6-241 | None |
| A0A287TPH0 | 15-254 | None |
| A0A804L861 | 74-330 | None |
| A0A7I8LGN4 | 94-322 | None |
| K7LKD4 | 1-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.