DPCstruct | MC63407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 198 ± 29 aa |
| Standard deviation of domain lengths | 28.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811NRK6 | 33-190 | AGDHRPHQVVKDRGVHAGGVGQLHRLVYVKKNAAEAPLLLGNDANRTSGGRGARPIVTDQLCAKGEFPPQALAPFQCCPPTTSASDP… |
| A0A4Y7K2D6 | 566-715 | LSPNLTTCHPSYTEQHKHVKCCPPKRLSEEPIIDFQFPDPSAQPIRVRRPAHVMSQDIDFVAKYNKAIAIMKSLPYDDPRNFMRQAN… |
| A0A396I5T8 | 37-249 | None |
| A0A7J9LCG8 | 2-185 | None |
| B9XQZ3 | 372-569 | None |
| A0A4Y7KXC4 | 462-672 | None |
| C7IXC9 | 25-228 | None |
| K7L2N9 | 1-149 | None |
| A0A5D2I4R7 | 8-214 | None |
| A0A6G8G213 | 110-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.