DPCstruct | MC63404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 228 ± 38 aa |
| Standard deviation of domain lengths | 37.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811NJE5 | 197-458 | QEEEESSSSDDDEDEDLDDDDECSVGSDIAHYLMGRHDDTPMIDKETHRLAVVNMDWDHIKAVDLYMVMTSCLPKGGRVLSVSIYPS… |
| D5ABU9 | 1-176 | MDWNHIKAVDLLVCMNCFLPKGGQILTVAVYPSEFGLKRMAEEAVRGPALFGSDDESSEDDQDELENEKLRQYEKDRLRYYFAVIEC… |
| A0A2N6P2H3 | 223-415 | None |
| A0A7R9Y5M7 | 2-205 | None |
| A0A0C2IKK5 | 1-184 | None |
| A0A5B6YSK6 | 9-258 | None |
| A0A284R9R7 | 109-400 | None |
| A0A194RH31 | 133-370 | None |
| A0A816IF77 | 77-287 | None |
| A0A505I0A0 | 43-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.