DPCstruct | MC63402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811NAG3 | 1-154 | MAGISDASLEPLIEFNFQWQVSRTIYRKHKASLSGGIMSPQDSPYLKAGITFSPHGSSVDMIPENKSSEAREIVGGDQLLHTNITMQ… |
| A0A811NBY9 | 1-102 | MVGDWPPLKLGVGFAPHFCNECMQGKTGVEVIKGKTEPISDSLQQMDEMVRLKAIDCYICQPDLSDYRMRLYAGHGVAYFIVRNQAL… |
| A0A811NE30 | 98-226 | None |
| A0A1E5VF53 | 51-209 | None |
| A0A0P0YA38 | 1-169 | None |
| A0A3L6PU36 | 61-202 | None |
| A0A1E5UR56 | 63-209 | None |
| A0A0E0HW50 | 832-973 | None |
| A0A6G1F4R4 | 1-134 | None |
| A0A0E0LGI7 | 352-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.