DPCstruct | MC6340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Standard deviation of domain lengths | 11.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1KZ83 | 9-150 | EHSVSTAMVALLNELTTYNTVATNKLSLGVTQFSKARSVQEYQQIGICVRDSWIEFAQSIFRPEFCPAGQQVPGPADVKRMIEHTLR… |
| A0A0U3GMF2 | 25-160 | AEAVSPHRILGWAEIDTEIGELRRHFRTARTPQDYRAVGNDCVHVTEALSRKVYDHPKHTPPGEDEPKVANTKLRLERYIEARLPES… |
| A0A2W4BHN3 | 1-127 | None |
| A0A6S7DLQ8 | 6-147 | None |
| A0A0F9QGQ0 | 33-192 | None |
| D0L895 | 370-526 | None |
| A0A7W7D5K1 | 72-234 | None |
| A0A1C0AMT3 | 105-247 | None |
| A0A833JQZ7 | 77-236 | None |
| A0A7Z0TSA6 | 74-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.