DPCstruct | MC634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345SWY0 | 1-75 | MRCTIAGYSFELNVGDVERALSGVKPEPITGESVRIGNHFYPVKQAGAVITRQDRRDFSAAEVSRALRKLGFTCR |
| A0A7D4PT61 | 4-91 | YSALTDRSAVHQALEEFDRIGRDEFLHKYGFGPARQYMLTTEHGSYDSKAIFGVAYGYQHGTALTSDEFSGGRMGAAGRLAELGFTVT |
| A0A7C0U225 | 19-110 | None |
| A0A6L8A0Z7 | 3-100 | None |
| A0A108E511 | 3-116 | None |
| A0A7C1L1I7 | 2-98 | None |
| A0A7L4ZF73 | 1-90 | None |
| A0A7Y4WBD3 | 101-178 | None |
| A0A178WNY7 | 1-89 | None |
| A0A3G8XHX4 | 11-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.