DPCstruct | MC63393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 164 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LW09 | 1-165 | MHVIISNQEHPESHPQECAFLRGLIGEFTTAVMAWVRQQHPDARFEVLYPPDVNDTPLNKAVNLPAEWMPAQLECFKTENFTFTGNR… |
| A0A0S6WY97 | 207-368 | IPDMRAPLTPAQTDLLDAAGALLAQSTAALVSAVRAAVAPDPVEALALVFTPTILAPAMPELYRANLPLGWAAPAFDRLQVEDYDWL… |
| A0A249SL15 | 413-568 | None |
| A0A846V4X0 | 410-595 | None |
| A0A352H5V5 | 54-225 | None |
| A0A840ZDP6 | 958-1144 | None |
| A0A510WF11 | 179-334 | None |
| A0A1L3ZU02 | 186-352 | None |
| A0A501XDD3 | 412-551 | None |
| A0A6B8LW33 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.