DPCstruct | MC6339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834LFD9 | 242-388 | VSLNEPLSADTDMELTEKEISDLASWLGGTYVAKALEPMTGELTIPLASGASLNLHMSKKADREFIGSLVSLIRNIRRAMDMHQDLS… |
| A0A5D2MAF2 | 1-142 | MISLDCPLGDYREEEINEFASWLGGSYATDVTKPLDGVLTIPLANGDNMNLHMSKKVHREFASKLFALYRNIRKAMERHEDLSQTLR… |
| A0A830C8Y7 | 109-257 | None |
| A0A2U1PVQ1 | 142-277 | None |
| A0A7J6FBM5 | 144-281 | None |
| A0A1I9VZX8 | 167-327 | None |
| A0A4Y7J6D4 | 113-244 | None |
| A0A059B1X8 | 58-205 | None |
| U5D9D0 | 226-376 | None |
| A0A1U7WER0 | 397-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.