DPCstruct | MC63384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 110 ± 22 aa |
| Standard deviation of domain lengths | 22.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660VK43 | 7-110 | LSYVTHLEGAIDGARLPARTLQTLHEGRPILVRYDLDGVRAAVDRDALAARPDGLWRYRELLPLDDGDEVVSLGETTTPLLDCPRLA… |
| A0A7C4GGX9 | 4-112 | VSHLECSATGKTYEAGRPYNLSDAGAPLLVRYDLAKARAQWNRESIARGPGSMWRYAPMLPVRDLSHVVSLGEGMTPLMKTTRLGLP… |
| A0A2V9X9Z8 | 2-97 | None |
| A0A662MLK2 | 5-98 | None |
| A0A2V7QQ05 | 5-118 | None |
| A0A3L6DBR9 | 278-451 | None |
| A0A096BEJ8 | 3-82 | None |
| A0A537GMQ7 | 5-106 | None |
| A0A1I1M8E0 | 3-108 | None |
| A0A1W9UYL4 | 4-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.